PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DS_A0EC5D808.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 378aa    MW: 41337.8 Da    PI: 6.5761
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DS_A0EC5D808.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-17653148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT++Ed+llv+ v+++G g+W+++ r+ g+ R++k+c++rw ++l
  Traes_6DS_A0EC5D808.1  6 KGPWTPDEDQLLVEHVRRHGEGSWNAVRRETGLLRCGKSCRLRWANHL 53
                           79******************************99**********9986 PP

2Myb_DNA-binding51.72.1e-1659102146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg++++eE+ l+++++++ G++ W++I+++++ gRt++++k++w++
  Traes_6DS_A0EC5D808.1  59 RGPFSPEEERLILRLHALIGNK-WARISAHLP-GRTDNEIKNYWNT 102
                            89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.158153IPR017930Myb domain
SuperFamilySSF466898.24E-313100IPR009057Homeodomain-like
SMARTSM007171.6E-14555IPR001005SANT/Myb domain
PfamPF002494.3E-16653IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-22760IPR009057Homeodomain-like
CDDcd001673.93E-12853No hitNo description
PROSITE patternPS0017502130IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129426.72454108IPR017930Myb domain
SMARTSM007176.8E-1758106IPR001005SANT/Myb domain
PfamPF002499.6E-1659102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-2661107IPR009057Homeodomain-like
CDDcd001672.19E-1261104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
GGRLKKGPWT PDEDQLLVEH VRRHGEGSWN AVRRETGLLR CGKSCRLRWA NHLRPNLKRG  60
PFSPEEERLI LRLHALIGNK WARISAHLPG RTDNEIKNYW NTRLKRRKRA GMALYPPDVE  120
REVALVRAGK LRPIVDADGN ASSLQAPLLL DAAADQFAWP AAPPFHPAYN NVAPPQPFQF  180
TGNISHNPQA LLAAQVPYLH HDEVSAGLGH ANKLYADAPG MPPLVPPAVQ ELPSNQSPAD  240
AGGPLEMLVL EQDQRLPGAA LLRVTSMPEL VYNENDYSAW PSGLSGGSGS RSEGDVTSHY  300
GGKCDCFGAD GVKPAKRMAA SLVVAEEEVS GLFGGEDLVE VWPDKPPESI TKDDFNLQME  360
MQHLMPPVPL SADEHGLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-3041075107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3731080.0AK373108.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3021G02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966213.11e-104PREDICTED: uncharacterized protein LOC101767992 isoform X1
TrEMBLW5H4250.0W5H425_WHEAT; Uncharacterized protein
STRINGSi006555m1e-103(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123972632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.29e-61myb domain protein 101
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]